PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_37114_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MYB
Protein Properties Length: 322aa    MW: 35591.6 Da    PI: 6.7752
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_37114_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.78.5e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd  l+++v+ +G+g +W + +++ g++R++k+c++rw++yl
   Neem_37114_f_1 14 RGPWSPEEDATLKRYVETYGTGgNWIALPHKAGLRRCGKSCRLRWLNYL 62
                     89*********************************************97 PP

2Myb_DNA-binding46.96.2e-1569111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g++ +eEd+++  +  qlG++ W+ Ia++++ gRt++++k++w++
   Neem_37114_f_1  69 GNFNEEEDQIICTLYSQLGSR-WSIIASHLP-GRTDNDVKNYWNT 111
                      899******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.952962IPR017930Myb domain
SuperFamilySSF466893.15E-2811109IPR009057Homeodomain-like
SMARTSM007173.8E-121364IPR001005SANT/Myb domain
PfamPF002495.4E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-251569IPR009057Homeodomain-like
CDDcd001673.10E-91662No hitNo description
PROSITE profilePS5129424.11763117IPR017930Myb domain
SMARTSM007171.5E-1467115IPR001005SANT/Myb domain
PfamPF002495.9E-1369111IPR001005SANT/Myb domain
CDDcd001671.15E-1070111No hitNo description
Gene3DG3DSA:1.10.10.602.1E-2470117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009785Biological Processblue light signaling pathway
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MGRAPCCDKA NVKRGPWSPE EDATLKRYVE TYGTGGNWIA LPHKAGLRRC GKSCRLRWLN  60
YLRPDIKHGN FNEEEDQIIC TLYSQLGSRW SIIASHLPGR TDNDVKNYWN TKLKKKLLAG  120
KVSLGSDNMT NNFPASSNSD QTLLDSTPSL HSAPKSETYD PLFSAPQTQM SSPLPILTDI  180
GYGITVNTHE NLSLDPSNNH FIPRPGLMTR VSQFGTSLKN NSSILTSSQE GSCVSESNSL  240
AIDNKSLSLP GNNNGGVNED ADQILMDFGF GVPYEYVNNG LWYQEKVSNE VGLSYYPNLA  300
DSSNYADIKP PRGLNQSVIN QY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C3e-26141174105C-Myb DNA-Binding Domain
1mse_C3e-26141174105C-Myb DNA-Binding Domain
1gv2_A4e-26141174105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007012221.11e-128Myb domain protein 84, putative
TrEMBLA0A061GIZ21e-128A0A061GIZ2_THECC; Myb domain protein 84, putative
STRINGPOPTR_0006s25060.11e-104(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36890.19e-74MYB family protein